Recombinant Human SYP
Cat.No. : | SYP-31490TH |
Product Overview : | Recombinant full length Human Synaptophysin with N terminal proprietary tag; predicted MWt 60.54 kDa inclusive of tag. AAH64550.1 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 313 amino acids |
Description : | This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with X-linked mental retardation (XLMR). |
Molecular Weight : | 60.540kDa inclusive of tags |
Tissue specificity : | Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAI FAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLH QVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYS MGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSS AWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPG APEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDY GQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Sequence Similarities : | Belongs to the synaptophysin/synaptobrevin family.Contains 1 MARVEL domain. |
Gene Name | SYP synaptophysin [ Homo sapiens ] |
Official Symbol | SYP |
Synonyms | SYP; synaptophysin; |
Gene ID | 6855 |
mRNA Refseq | NM_003179 |
Protein Refseq | NP_003170 |
MIM | 313475 |
Uniprot ID | P08247 |
Chromosome Location | Xp11.23-p11.22 |
Function | SH2 domain binding; calcium ion binding; cholesterol binding; identical protein binding; syntaxin-1 binding; |
◆ Recombinant Proteins | ||
SYP-513HF | Recombinant Full Length Human SYP Protein | +Inquiry |
SYP-5533R | Recombinant Rat SYP Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17140RF | Recombinant Full Length Rat Synaptophysin(Syp) Protein, His-Tagged | +Inquiry |
RFL20132BF | Recombinant Full Length Bovine Synaptophysin(Syp) Protein, His-Tagged | +Inquiry |
SYP-31490TH | Recombinant Human SYP | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYP Products
Required fields are marked with *
My Review for All SYP Products
Required fields are marked with *
0
Inquiry Basket