Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged
Cat.No. : | SYP-2596H |
Product Overview : | Recombinant Human SYP protein(P08247)(228-313 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 228-313 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | WAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Gene Name | SYP synaptophysin [ Homo sapiens ] |
Official Symbol | SYP |
Synonyms | SYP; synaptophysin; major synaptic vesicle protein P38; MRXSYP; |
Gene ID | 6855 |
mRNA Refseq | NM_003179 |
Protein Refseq | NP_003170 |
MIM | 313475 |
UniProt ID | P08247 |
◆ Recombinant Proteins | ||
RFL20132BF | Recombinant Full Length Bovine Synaptophysin(Syp) Protein, His-Tagged | +Inquiry |
SYP-6387H | Recombinant Human SYP Protein (Glu50-Met313), N-His tagged | +Inquiry |
SYP-4587R | Recombinant Rhesus monkey SYP Protein, His-tagged | +Inquiry |
SYP-2747H | Recombinant Human SYP Protein, His-tagged | +Inquiry |
SYP-5874R | Recombinant Rat SYP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYP Products
Required fields are marked with *
My Review for All SYP Products
Required fields are marked with *