Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged

• Cat.No.: SYP-2596H
• Product Overview: Recombinant Human SYP protein(P08247)(228-313 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 228-313 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: WAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Gene Information

• Gene Name: SYP synaptophysin [ Homo sapiens ]
• Official Symbol: SYP
• Synonyms: SYP; synaptophysin; major synaptic vesicle protein P38; MRXSYP
• Gene ID: 6855
• mRNA Refseq: NM_003179
• Protein Refseq: NP_003170
• MIM: 313475
• UniProt ID: P08247