Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged

Cat.No. : SYP-2596H
Product Overview : Recombinant Human SYP protein(P08247)(228-313 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 228-313 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : WAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Gene Name SYP synaptophysin [ Homo sapiens ]
Official Symbol SYP
Synonyms SYP; synaptophysin; major synaptic vesicle protein P38; MRXSYP;
Gene ID 6855
mRNA Refseq NM_003179
Protein Refseq NP_003170
MIM 313475
UniProt ID P08247

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYP Products

Required fields are marked with *

My Review for All SYP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon