Recombinant Human SYT15 protein, GST-tagged
| Cat.No. : | SYT15-6784H |
| Product Overview : | Recombinant Human SYT15 protein(133-375 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 133-375 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | KFPEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| ◆ Recombinant Proteins | ||
| SYT15-6784H | Recombinant Human SYT15 protein, GST-tagged | +Inquiry |
| SYT15-3081H | Recombinant Human SYT15, His-tagged | +Inquiry |
| RFL17773RF | Recombinant Full Length Rat Synaptotagmin-15(Syt15) Protein, His-Tagged | +Inquiry |
| SYT15-8924M | Recombinant Mouse SYT15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYT15-16331M | Recombinant Mouse SYT15 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT15 Products
Required fields are marked with *
My Review for All SYT15 Products
Required fields are marked with *




