Recombinant Human SYT3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYT3-1880H |
Product Overview : | SYT3 MS Standard C13 and N15-labeled recombinant protein (NP_115674) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ca2+ sensor involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain. Ca2+ induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis. Plays a role in dendrite formation by melanocytes. |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNDRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYT3 synaptotagmin III [ Homo sapiens (human) ] |
Official Symbol | SYT3 |
Synonyms | SYT3; synaptotagmin 3; SytIII; synaptotagmin-3; synaptotagmin III |
Gene ID | 84258 |
mRNA Refseq | NM_032298 |
Protein Refseq | NP_115674 |
MIM | 600327 |
UniProt ID | Q9BQG1 |
◆ Recombinant Proteins | ||
SYT3-3084H | Recombinant Human SYT3, GST-tagged | +Inquiry |
SYT3-144H | Recombinant Human SYT3, His-tagged | +Inquiry |
SYT3-1880H | Recombinant Human SYT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYT3-5881R | Recombinant Rat SYT3 Protein | +Inquiry |
RFL34284RF | Recombinant Full Length Rat Synaptotagmin-3(Syt3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT3-1305HCL | Recombinant Human SYT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYT3 Products
Required fields are marked with *
My Review for All SYT3 Products
Required fields are marked with *
0
Inquiry Basket