Recombinant Human SYT6 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYT6-329H |
Product Overview : | SYT6 MS Standard C13 and N15-labeled recombinant protein (NP_995320) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the synaptotagmin family. Synaptotagmins share a common domain structure that includes a transmembrane domain and a cytoplasmic region composed of 2 C2 domains, and are involved in calcium-dependent exocytosis of synaptic vesicles. This protein has been shown to be a key component of the secretory machinery involved in acrosomal exocytosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYT6 synaptotagmin VI [ Homo sapiens (human) ] |
Official Symbol | SYT6 |
Synonyms | SYT6; synaptotagmin VI; synaptotagmin-6; sytVI; |
Gene ID | 148281 |
mRNA Refseq | NM_205848 |
Protein Refseq | NP_995320 |
MIM | 607718 |
UniProt ID | Q5T7P8 |
◆ Recombinant Proteins | ||
SYT6-3051H | Recombinant Human SYT6 protein, His-tagged | +Inquiry |
SYT6-3093H | Recombinant Human SYT6 Protein, MYC/DDK-tagged | +Inquiry |
SYT6-5884R | Recombinant Rat SYT6 Protein | +Inquiry |
Syt6-6263M | Recombinant Mouse Syt6 Protein, Myc/DDK-tagged | +Inquiry |
SYT6-8930M | Recombinant Mouse SYT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT6-647HCL | Recombinant Human SYT6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT6 Products
Required fields are marked with *
My Review for All SYT6 Products
Required fields are marked with *
0
Inquiry Basket