Recombinant Human T-lymphotropic virus HTLV2gp6 Protein, His-tagged

• Cat.No.: HTLV2gp6-22H
• Product Overview: Recombinant Human T-lymphotropic virus HTLV2gp6 Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Human T-lymphotropic virus
• Source: HEK293
• Tag: His
• Description: hypothetical protein
• Form: PBS, pH7.4
• Molecular Mass: 33.3 kDa
• AA Sequence: QQSRCTLTIGISSYHSSPCSPTQPVCTWNLDLNSLTTDQRLHPPCPNLITYSGFHKTYSLYLFPHWIKKPNRQGLGYYSPSYNDPCSLQCPYLGCQAWTSAYTGPVSSPSWKFHSDVNFTQEVSQVSLRLHFSKCGSSMTLLVDAPGYDPLWFITSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKFIQLTLQSTNYSCMVCVDRSSLSSWHVLYTPNISIPQQTSSRTILFPSLALPAPPSQPFPWTHCYQPRLQAITTDNCNNSIILPPFSLAPVPPPATRRRRHHHHHH
• Purity: ＞50%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.21mg/ml

Gene Information

• Gene Name: HTLV2gp6 hypothetical protein [ Human T-lymphotropic virus 2 ]
• Official Symbol: HTLV2gp6
• Gene ID: 1491942
• Protein Refseq: NP_041006
• UniProt ID: P03383