Recombinant Human TAAR6 Protein
Cat.No. : | TAAR6-676H |
Product Overview : | Recombinant Human TAAR6 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The TAAR6 (TRAR4) gene belongs to the trace amine receptor family. Trace amines are endogenous amine compounds that are chemically similar to classic biogenic amines like dopamine, norepinephrine, serotonin, and histamine. Trace amines were thought to be 'false transmitters' that displace classic biogenic amines from their storage and act on transporters in a fashion similar to the amphetamines, but the identification of brain receptors specific to trace amines indicates that they also have effects of their own (Duan et al., 2004 [PubMed 15329799]). |
Form : | Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI |
Applications : | Antibody Production |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TAAR6 trace amine associated receptor 6 [ Homo sapiens (human) ] |
Official Symbol | TAAR6 |
Synonyms | RP11-295F4.3; SCZD5; TA4; TRAR4; |
Gene ID | 319100 |
mRNA Refseq | NM_175067 |
Protein Refseq | NP_778237 |
UniProt ID | Q96RI8 |
◆ Recombinant Proteins | ||
TAAR6-16356M | Recombinant Mouse TAAR6 Protein | +Inquiry |
TAAR6-6809HF | Recombinant Full Length Human TAAR6 Protein, GST-tagged | +Inquiry |
RFL18209RF | Recombinant Full Length Rat Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
TAAR6-6822HF | Recombinant Full Length Human TAAR6 Protein | +Inquiry |
RFL35323PF | Recombinant Full Length Pan Troglodytes Trace Amine-Associated Receptor 6(Taar6) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAAR6 Products
Required fields are marked with *
My Review for All TAAR6 Products
Required fields are marked with *