Recombinant Human TAAR6 Protein

Cat.No. : TAAR6-676H
Product Overview : Recombinant Human TAAR6 Full-Length ORF Protein is produced by Wheat Germ (in vitro) expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The TAAR6 (TRAR4) gene belongs to the trace amine receptor family. Trace amines are endogenous amine compounds that are chemically similar to classic biogenic amines like dopamine, norepinephrine, serotonin, and histamine. Trace amines were thought to be 'false transmitters' that displace classic biogenic amines from their storage and act on transporters in a fashion similar to the amphetamines, but the identification of brain receptors specific to trace amines indicates that they also have effects of their own
(Duan et al., 2004 [PubMed 15329799]).
Form : Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 38.5 kDa
AA Sequence : MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
Applications : Antibody Production
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TAAR6 trace amine associated receptor 6 [ Homo sapiens (human) ]
Official Symbol TAAR6
Synonyms RP11-295F4.3; SCZD5; TA4; TRAR4;
Gene ID 319100
mRNA Refseq NM_175067
Protein Refseq NP_778237
UniProt ID Q96RI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAAR6 Products

Required fields are marked with *

My Review for All TAAR6 Products

Required fields are marked with *

0
cart-icon
0
compare icon