Recombinant Human TAC3, His-tagged
Cat.No. : | TAC3-29652TH |
Product Overview : | Recombinant full length Human Neurokinin B with an N terminal His tag; 125 amino acids with a predicted MWt 13.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 105 amino acids |
Description : | This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 13.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGR SKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTS PEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKY PPRAE |
Sequence Similarities : | Belongs to the tachykinin family. |
Gene Name | TAC3 tachykinin 3 [ Homo sapiens ] |
Official Symbol | TAC3 |
Synonyms | TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1; |
Gene ID | 6866 |
mRNA Refseq | NM_001178054 |
Protein Refseq | NP_001171525 |
MIM | 162330 |
Uniprot ID | Q9UHF0 |
Chromosome Location | 12q13-q21 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; |
Function | receptor binding; |
◆ Recombinant Proteins | ||
TAC3-6390H | Recombinant Human TAC3 Protein (Cys23-Glu121), N-His tagged | +Inquiry |
TAC3-79H | Recombinant Human Tachykinin 3, His-tagged | +Inquiry |
TAC3-4009H | Recombinant Human TAC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAC3-29653TH | Recombinant Human TAC3, His-tagged | +Inquiry |
TAC3-3093H | Recombinant Human TAC3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAC3 Products
Required fields are marked with *
My Review for All TAC3 Products
Required fields are marked with *