Recombinant Human TAC3, His-tagged

Cat.No. : TAC3-29652TH
Product Overview : Recombinant full length Human Neurokinin B with an N terminal His tag; 125 amino acids with a predicted MWt 13.8 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 105 amino acids
Description : This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 13.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHQSFGAVCKEPQEEVVPGGGR SKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTS PEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKY PPRAE
Sequence Similarities : Belongs to the tachykinin family.
Gene Name TAC3 tachykinin 3 [ Homo sapiens ]
Official Symbol TAC3
Synonyms TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1;
Gene ID 6866
mRNA Refseq NM_001178054
Protein Refseq NP_001171525
MIM 162330
Uniprot ID Q9UHF0
Chromosome Location 12q13-q21
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem;
Function receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAC3 Products

Required fields are marked with *

My Review for All TAC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon