Recombinant Human TAC3 Protein, His-tagged

• Cat.No.: TAC3-31H
• Product Overview: Recombinant Human TAC3 Protein(1-121 aa), fused with N-terminal His Tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-121 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: TAC3 tachykinin 3 [ Homo sapiens ]
• Official Symbol: TAC3
• Synonyms: TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1; neuromedin K; gamma tachykinin 3; preprotachykinin B; NKNB; PRO1155
• Gene ID: 6866
• mRNA Refseq: NM_001178054
• Protein Refseq: NP_001171525
• MIM: 162330
• UniProt ID: Q9UHF0