Recombinant Human TAC3 Protein, His-tagged
| Cat.No. : | TAC3-31H |
| Product Overview : | Recombinant Human TAC3 Protein(1-121 aa), fused with N-terminal His Tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-121 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | TAC3 tachykinin 3 [ Homo sapiens ] |
| Official Symbol | TAC3 |
| Synonyms | TAC3; tachykinin 3; neurokinin beta , neuromedin K , NKNB; tachykinin-3; NKB; ZNEUROK1; neuromedin K; gamma tachykinin 3; preprotachykinin B; NKNB; PRO1155; |
| Gene ID | 6866 |
| mRNA Refseq | NM_001178054 |
| Protein Refseq | NP_001171525 |
| MIM | 162330 |
| UniProt ID | Q9UHF0 |
| ◆ Recombinant Proteins | ||
| TAC3-6390H | Recombinant Human TAC3 Protein (Cys23-Glu121), N-His tagged | +Inquiry |
| TAC3-3093H | Recombinant Human TAC3, GST-tagged | +Inquiry |
| TAC3-29652TH | Recombinant Human TAC3, His-tagged | +Inquiry |
| TAC3-31H | Recombinant Human TAC3 Protein, His-tagged | +Inquiry |
| Tac3-5805R | Recombinant Rat Tac3 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAC3 Products
Required fields are marked with *
My Review for All TAC3 Products
Required fields are marked with *
