Recombinant Human TAC4 Protein, His-tagged

• Cat.No.: TAC4-32H
• Product Overview: Recombinant Human TAC4 Protein(Q86UU9)(31-110 aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 31-110 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 12 kDa
• AASequence: EAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQ
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.