Recombinant Human TACSTD2 protein, T7/His-tagged
| Cat.No. : | TACSTD2-81H |
| Product Overview : | Recombinant human TACSTD2 cDNA (27 – 274 aa, derived from BC009409) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 27-274 a.a. |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSK CLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDE LVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDA AYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro TACSTD2 protein mediated calcium related signal pathway for cancer cell growth regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as TACSTD2 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
| Official Symbol | TACSTD2 |
| Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker prote |
| Gene ID | 4070 |
| mRNA Refseq | NM_002353 |
| Protein Refseq | NP_002344 |
| MIM | 137290 |
| UniProt ID | P09758 |
| Chromosome Location | 1p32 |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| TACSTD2-7217H | Recombinant Human TACSTD2, His-tagged | +Inquiry |
| TACSTD2-0770H | Active Recombinant Human TACSTD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| TACSTD2-219H | Active Recombinant Human TACSTD2 protein, hFc-tagged | +Inquiry |
| TACSTD2-1848H | Active Recombinant Human TACSTD2 protein, His & Avi-tagged, Biotinylated | +Inquiry |
| TACSTD2-735H | Recombinant Human TACSTD2 Protein (His27-Thr274), C-mFc and 6×His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TACSTD2-78H | Active Recombinant Human TACSTD2 Protein, Flag&His tagged | +Inquiry |
| Tacstd2-64M | Active Recombinant Mouse Tacstd2 Homodimer Protein, Flag&His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
| TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
