Recombinant Human TAFA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TAFA1-2222H
Product Overview : FAM19A1 MS Standard C13 and N15-labeled recombinant protein (NP_998774) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines that act as regulators of immune and nervous cells.
Molecular Mass : 14.9 kDa
AA Sequence : MAMVSAMSWVLYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TAFA1 TAFA chemokine like family member 1 [ Homo sapiens (human) ]
Official Symbol TAFA1
Synonyms TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1
Gene ID 407738
mRNA Refseq NM_213609
Protein Refseq NP_998774
MIM 617495
UniProt ID Q7Z5A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAFA1 Products

Required fields are marked with *

My Review for All TAFA1 Products

Required fields are marked with *

0
cart-icon