Recombinant Human TAFA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TAFA1-2222H |
| Product Overview : | FAM19A1 MS Standard C13 and N15-labeled recombinant protein (NP_998774) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines that act as regulators of immune and nervous cells. |
| Molecular Mass : | 14.9 kDa |
| AA Sequence : | MAMVSAMSWVLYLWISACAMLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TAFA1 TAFA chemokine like family member 1 [ Homo sapiens (human) ] |
| Official Symbol | TAFA1 |
| Synonyms | TAFA1; TAFA chemokine like family member 1; TAFA-1; FAM19A1; chemokine-like protein TAFA-1; family with sequence similarity 19 (chemokine (C-C motif)-like), member A1; family with sequence similarity 19 member A1, C-C motif chemokine like; protein FAM19A1 |
| Gene ID | 407738 |
| mRNA Refseq | NM_213609 |
| Protein Refseq | NP_998774 |
| MIM | 617495 |
| UniProt ID | Q7Z5A9 |
| ◆ Recombinant Proteins | ||
| TAFA1-2154H | Recombinant Human TAFA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAFA1-2222H | Recombinant Human TAFA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Tafa1-6280M | Recombinant Mouse Tafa1 Protein, Myc/DDK-tagged | +Inquiry |
| Tafa1-4582M | Recombinant Mouse Tafa1 protein, His&Myc-tagged | +Inquiry |
| TAFA1-1744HFL | Recombinant Full Length Human TAFA1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAFA1 Products
Required fields are marked with *
My Review for All TAFA1 Products
Required fields are marked with *
