Recombinant Human TAGLN protein, GST-tagged
| Cat.No. : | TAGLN-3109H |
| Product Overview : | Recombinant Human TAGLN protein(1-201 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TAGLN transgelin [ Homo sapiens ] |
| Official Symbol | TAGLN |
| Synonyms | TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10; SM22-alpha; 22 kDa actin-binding protein; smooth muscle protein 22-alpha; WS3-10; DKFZp686B01212; |
| Gene ID | 6876 |
| mRNA Refseq | NM_001001522 |
| Protein Refseq | NP_001001522 |
| MIM | 600818 |
| UniProt ID | Q01995 |
| ◆ Recombinant Proteins | ||
| TAGLN-1001C | Recombinant Cynomolgus TAGLN Protein, His-tagged | +Inquiry |
| TAGLN-744C | Recombinant Cynomolgus Monkey TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAGLN-7043C | Recombinant Chicken TAGLN | +Inquiry |
| TAGLN-5578R | Recombinant Rat TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAGLN-4409Z | Recombinant Zebrafish TAGLN | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAGLN-1262HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
| TAGLN-1263HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN Products
Required fields are marked with *
My Review for All TAGLN Products
Required fields are marked with *
