Recombinant Human TAGLN, His-tagged
Cat.No. : | TAGLN-30926TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 4-201 of Human SM22 alpha with N terminal His tag; 198 amino acids, 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4-201 a.a. |
Description : | The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | KGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVG RPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPE NPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGK DMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEH KREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPR QIIS |
Sequence Similarities : | Belongs to the calponin family.Contains 1 calponin-like repeat.Contains 1 CH (calponin-homology) domain. |
Gene Name | TAGLN transgelin [ Homo sapiens ] |
Official Symbol | TAGLN |
Synonyms | TAGLN; transgelin; DKFZp686P11128; SM22; SM22 alpha; SMCC; TAGLN1; transgelin variant 2; WS3 10; |
Gene ID | 6876 |
mRNA Refseq | NM_001001522 |
Protein Refseq | NP_001001522 |
MIM | 600818 |
Uniprot ID | Q01995 |
Chromosome Location | 11q23.2 |
Function | actin binding; |
◆ Recombinant Proteins | ||
TAGLN-3264H | Recombinant Human TAGLN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAGLN-744C | Recombinant Cynomolgus Monkey TAGLN Protein, His (Fc)-Avi-tagged | +Inquiry |
TAGLN-30926TH | Recombinant Human TAGLN, His-tagged | +Inquiry |
TAGLN-16408M | Recombinant Mouse TAGLN Protein | +Inquiry |
TAGLN-5919R | Recombinant Rat TAGLN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAGLN-1262HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
TAGLN-1263HCL | Recombinant Human TAGLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAGLN Products
Required fields are marked with *
My Review for All TAGLN Products
Required fields are marked with *
0
Inquiry Basket