Recombinant Human TANK protein, GST-tagged

• Cat.No.: TANK-3551H
• Product Overview: Recombinant Human TANK protein(Q92844)(1-119aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-119aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.8 kDa
• AA Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TANK TRAF family member-associated NFKB activator [ Homo sapiens ]
• Official Symbol: TANK
• Synonyms: TANK; TRAF family member-associated NFKB activator; TRAF2; TRAF family member-associated NF-kappa-B activator; I TRAF; TRAF-interacting protein; I-TRAF
• Gene ID: 10010
• mRNA Refseq: NM_004180
• Protein Refseq: NP_004171
• MIM: 603893
• UniProt ID: Q92844