Recombinant Human TANK protein, GST-tagged
Cat.No. : | TANK-3551H |
Product Overview : | Recombinant Human TANK protein(Q92844)(1-119aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TANK TRAF family member-associated NFKB activator [ Homo sapiens ] |
Official Symbol | TANK |
Synonyms | TANK; TRAF family member-associated NFKB activator; TRAF2; TRAF family member-associated NF-kappa-B activator; I TRAF; TRAF-interacting protein; I-TRAF; |
Gene ID | 10010 |
mRNA Refseq | NM_004180 |
Protein Refseq | NP_004171 |
MIM | 603893 |
UniProt ID | Q92844 |
◆ Recombinant Proteins | ||
TANK-4496Z | Recombinant Zebrafish TANK | +Inquiry |
TANK-31443TH | Recombinant Human TANK | +Inquiry |
TANK-517H | Recombinant Human TANK | +Inquiry |
TANK-4997H | Recombinant Human TANK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TANK-4431R | Recombinant Rhesus Macaque TANK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TANK-1256HCL | Recombinant Human TANK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TANK Products
Required fields are marked with *
My Review for All TANK Products
Required fields are marked with *