Recombinant Human TAOK1 protein, GST-tagged

• Cat.No.: TAOK1-32H
• Product Overview: Recombinant Human TAOK1 protein(371-440 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 371-440 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: LPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQVSRHKSHYRNREHFAT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: TAOK1 TAO kinase 1 [ Homo sapiens ]
• Official Symbol: TAOK1
• Synonyms: TAOK1; TAO kinase 1; serine/threonine-protein kinase TAO1; FLJ14314; KIAA1361; MAP3K16; MARKK; PSK2; TAO1; MARK Kinase; STE20-like kinase PSK2; kinase from chicken homolog B; prostate-derived STE20-like kinase 2; thousand and one amino acid protein 1; prostate-derived sterile 20-like kinase 2; serine/threonine protein kinase TAO1 homolog; thousand and one amino acid protein kinase 1; microtubule affinity regulating kinase kinase; KFC-B; PSK-2; hKFC-B; hTAOK1
• Gene ID: 57551
• mRNA Refseq: NM_020791
• Protein Refseq: NP_065842
• MIM: 610266
• UniProt ID: Q7L7X3