Recombinant Human TAPBP

Cat.No. : TAPBP-31499TH
Product Overview : Recombinant fragment Human Tapasin with N-terminal proprietary tag. Predicted MW 37.07kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 104 amino acids
Description : This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
Molecular Weight : 37.070kDa inclusive of tags
Tissue specificity : Neutrophils, mostly in fully differentiated cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAV AFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLP YLQGQVTLELAVYKPPKVSLMPAT
Sequence Similarities : Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
Gene Name TAPBP TAP binding protein (tapasin) [ Homo sapiens ]
Official Symbol TAPBP
Synonyms TAPBP; TAP binding protein (tapasin); tapasin; TAPA;
Gene ID 6892
mRNA Refseq NM_172209
Protein Refseq NP_757346
MIM 601962
Uniprot ID O15533
Chromosome Location 6p21.3
Pathway Adaptive Immune System, organism-specific biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem;
Function MHC class I protein binding; TAP1 binding; TAP1 binding; TAP2 binding; TAP2 binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAPBP Products

Required fields are marked with *

My Review for All TAPBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon