Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TAPBP

Cat.No. : TAPBP-31499TH
Product Overview : Recombinant fragment Human Tapasin with N-terminal proprietary tag. Predicted MW 37.07kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
Protein length : 104 amino acids
Molecular Weight : 37.070kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Neutrophils, mostly in fully differentiated cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAV AFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLP YLQGQVTLELAVYKPPKVSLMPAT
Sequence Similarities : Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
Gene Name : TAPBP TAP binding protein (tapasin) [ Homo sapiens ]
Official Symbol : TAPBP
Synonyms : TAPBP; TAP binding protein (tapasin); tapasin; TAPA;
Gene ID : 6892
mRNA Refseq : NM_172209
Protein Refseq : NP_757346
MIM : 601962
Uniprot ID : O15533
Chromosome Location : 6p21.3
Pathway : Adaptive Immune System, organism-specific biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem;
Function : MHC class I protein binding; TAP1 binding; TAP1 binding; TAP2 binding; TAP2 binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends