Recombinant Human TAS2R10 protein, GST-tagged

• Cat.No.: TAS2R10-4633H
• Product Overview: Recombinant Human TAS2R10 protein(148-227 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 148-227 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: AKILNDYKMKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TAS2R10 taste receptor, type 2, member 10 [ Homo sapiens ]
• Official Symbol: TAS2R10
• Synonyms: TAS2R10; taste receptor, type 2, member 10; taste receptor type 2 member 10; T2R10; TRB2; taste receptor family B member 2; taste receptor, family B, member 2; MGC126811; MGC126813
• Gene ID: 50839
• mRNA Refseq: NM_023921
• Protein Refseq: NP_076410
• MIM: 604791
• UniProt ID: Q9NYW0