Recombinant Human TAS2R10 protein, His-KSI-tagged
| Cat.No. : | TAS2R10-6874H |
| Product Overview : | Recombinant Human TAS2R10 protein(Q9NYW0)(64-100aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 64-100a.a. |
| Tag : | His-KSI |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFAT |
| Gene Name | TAS2R10 taste receptor, type 2, member 10 [ Homo sapiens ] |
| Official Symbol | TAS2R10 |
| Synonyms | TAS2R10; taste receptor, type 2, member 10; taste receptor type 2 member 10; T2R10; TRB2; taste receptor family B member 2; taste receptor, family B, member 2; MGC126811; MGC126813; |
| Gene ID | 50839 |
| mRNA Refseq | NM_023921 |
| Protein Refseq | NP_076410 |
| MIM | 604791 |
| UniProt ID | Q9NYW0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAS2R10 Products
Required fields are marked with *
My Review for All TAS2R10 Products
Required fields are marked with *
