Recombinant Human TAU protein, GST-tagged
Cat.No. : | TAU-301451H |
Product Overview : | Recombinant Human TAU (87-172 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala87-Arg172 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MAPT microtubule associated protein tau [ Homo sapiens (human) ] |
Official Symbol | TAU |
Synonyms | MAPT; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103 |
Gene ID | 4137 |
mRNA Refseq | NM_001123066 |
Protein Refseq | NP_001116538 |
MIM | 157140 |
UniProt ID | 10636 |
◆ Recombinant Proteins | ||
MAPT-186H | Recombinant Human Tau-441 (216-391) | +Inquiry |
MAPT-5074H | Recombinant Human Microtubule-Associated Protein Tau, His-tagged | +Inquiry |
MAPT-4383H | Recombinant Human MAPT protein, His-tagged | +Inquiry |
MAPT-127H | Recombinant Human MAPT Protein, His-tagged | +Inquiry |
MAPT-10HFL | Recombinant Full Length Human microtubule associated protein tau Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPT-4476HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
MAPT-4477HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
MAPT-4478HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPT Products
Required fields are marked with *
My Review for All MAPT Products
Required fields are marked with *