Recombinant Human TBC1D23 protein, His-tagged
Cat.No. : | TBC1D23-3738H |
Product Overview : | Recombinant Human TBC1D23 protein(1-320 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-320 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TBC1D23 TBC1 domain family, member 23 [ Homo sapiens ] |
Official Symbol | TBC1D23 |
Synonyms | TBC1D23; TBC1 domain family, member 23; TBC1 domain family member 23; FLJ11046; HCV nonstructural protein 4A-transactivated protein 1; HCV non-structural protein 4A-transactivated protein 1; NS4ATP1; DKFZp667G062; |
Gene ID | 55773 |
mRNA Refseq | NM_001199198 |
Protein Refseq | NP_001186127 |
UniProt ID | Q9NUY8 |
◆ Recombinant Proteins | ||
TBC1D23-2483C | Recombinant Chicken TBC1D23 | +Inquiry |
TBC1D23-16491M | Recombinant Mouse TBC1D23 Protein | +Inquiry |
TBC1D23-3738H | Recombinant Human TBC1D23 protein, His-tagged | +Inquiry |
TBC1D23-9030M | Recombinant Mouse TBC1D23 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBC1D23-10784Z | Recombinant Zebrafish TBC1D23 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBC1D23-652HCL | Recombinant Human TBC1D23 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBC1D23 Products
Required fields are marked with *
My Review for All TBC1D23 Products
Required fields are marked with *
0
Inquiry Basket