Recombinant Human TBC1D23 protein, His-tagged

• Cat.No.: TBC1D23-32H
• Product Overview: Recombinant Human TBC1D23 protein(Q9NUY8)(531-610 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 531-610 aa
• Form: Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: TERHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHL
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TBC1D23 TBC1 domain family, member 23 [ Homo sapiens ]
• Official Symbol: TBC1D23
• Synonyms: TBC1D23; TBC1 domain family, member 23; TBC1 domain family member 23; FLJ11046; HCV nonstructural protein 4A-transactivated protein 1; HCV non-structural protein 4A-transactivated protein 1; NS4ATP1; DKFZp667G062
• Gene ID: 55773
• mRNA Refseq: NM_001199198
• Protein Refseq: NP_001186127
• UniProt ID: Q9NUY8