Recombinant Human TBC1D23 protein, His-tagged

Cat.No. : TBC1D23-32H
Product Overview : Recombinant Human TBC1D23 protein(Q9NUY8)(531-610 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 531-610 aa
Form : Phosphate buffered saline
Molecular Mass : 11 kDa
AASequence : TERHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHL
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TBC1D23 TBC1 domain family, member 23 [ Homo sapiens ]
Official Symbol TBC1D23
Synonyms TBC1D23; TBC1 domain family, member 23; TBC1 domain family member 23; FLJ11046; HCV nonstructural protein 4A-transactivated protein 1; HCV non-structural protein 4A-transactivated protein 1; NS4ATP1; DKFZp667G062;
Gene ID 55773
mRNA Refseq NM_001199198
Protein Refseq NP_001186127
UniProt ID Q9NUY8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBC1D23 Products

Required fields are marked with *

My Review for All TBC1D23 Products

Required fields are marked with *

0
cart-icon
0
compare icon