Recombinant Human TBC1D8 protein, GST-tagged
Cat.No. : | TBC1D8-2423H |
Product Overview : | Recombinant Human TBC1D8 protein(941-1140 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 941-1140 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | RNPLLSTSRPLVFGKPNGDAVDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TBC1D8 TBC1 domain family, member 8 (with GRAM domain) [ Homo sapiens ] |
Official Symbol | TBC1D8 |
Synonyms | TBC1D8; TBC1 domain family, member 8 (with GRAM domain); TBC1 domain family member 8; AD3; BUB2 like protein 1; HBLP1; vascular Rab GAP/TBC containing protein; VRP; AD 3; BUB2-like protein 1; TBC1 domain family, member 8A; vascular Rab-GAP/TBC-containing protein; TBC1D8A; |
Gene ID | 11138 |
mRNA Refseq | NM_001102426 |
Protein Refseq | NP_001095896 |
UniProt ID | O95759 |
◆ Recombinant Proteins | ||
TBC1D8-16499M | Recombinant Mouse TBC1D8 Protein | +Inquiry |
TBC1D8-9037M | Recombinant Mouse TBC1D8 Protein, His (Fc)-Avi-tagged | +Inquiry |
TBC1D8-2423H | Recombinant Human TBC1D8 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBC1D8 Products
Required fields are marked with *
My Review for All TBC1D8 Products
Required fields are marked with *