Recombinant Human TBC1D8 protein, GST-tagged

• Cat.No.: TBC1D8-2423H
• Product Overview: Recombinant Human TBC1D8 protein(941-1140 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 941-1140 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: RNPLLSTSRPLVFGKPNGDAVDYQKQLKQMIKDLAKEKDKTEKELPKMSQREFIQFCKTLYSMFHEDPEENDLYQAIATVTTLLLQIGEVGQRGSSSGSCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSELKLSNL
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TBC1D8 TBC1 domain family, member 8 (with GRAM domain) [ Homo sapiens ]
• Official Symbol: TBC1D8
• Synonyms: TBC1D8; TBC1 domain family, member 8 (with GRAM domain); TBC1 domain family member 8; AD3; BUB2 like protein 1; HBLP1; vascular Rab GAP/TBC containing protein; VRP; AD 3; BUB2-like protein 1; TBC1 domain family, member 8A; vascular Rab-GAP/TBC-containing protein; TBC1D8A
• Gene ID: 11138
• mRNA Refseq: NM_001102426
• Protein Refseq: NP_001095896
• UniProt ID: O95759