Recombinant Human TBCA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TBCA-3190H |
| Product Overview : | TBCA MS Standard C13 and N15-labeled recombinant protein (NP_004598) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 12.9 kDa |
| AA Sequence : | MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TBCA tubulin folding cofactor A [ Homo sapiens (human) ] |
| Official Symbol | TBCA |
| Synonyms | TBCA; tubulin folding cofactor A; tubulin specific chaperone a; tubulin-specific chaperone A; CFA; chaperonin cofactor A; TCP1-chaperonin cofactor A; tubulin-folding cofactor A; |
| Gene ID | 6902 |
| mRNA Refseq | NM_004607 |
| Protein Refseq | NP_004598 |
| MIM | 610058 |
| UniProt ID | O75347 |
| ◆ Recombinant Proteins | ||
| Tbca-8068M | Recombinant Mouse Tbca protein, His & T7-tagged | +Inquiry |
| TBCA-8620H | Recombinant Human TBCA, GST tagged | +Inquiry |
| TBCA-9041M | Recombinant Mouse TBCA Protein, His (Fc)-Avi-tagged | +Inquiry |
| TBCA-4020C | Recombinant Chicken TBCA | +Inquiry |
| TBCA-3190H | Recombinant Human TBCA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TBCA-1220HCL | Recombinant Human TBCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCA Products
Required fields are marked with *
My Review for All TBCA Products
Required fields are marked with *
