Recombinant Human TBK1 Protein, His-tagged
Cat.No. : | TBK1-338H |
Product Overview : | Recombinant Human TBK1 Protein(NP_037386)(590-729 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 590-729 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TBK1 TANK-binding kinase 1 [ Homo sapiens ] |
Official Symbol | TBK1 |
Synonyms | TBK1; TANK-binding kinase 1; serine/threonine-protein kinase TBK1; NAK; NF-kB-activating kinase; NF-kappa-B-activating kinase; T2K; FLJ11330; |
Gene ID | 29110 |
mRNA Refseq | NM_013254 |
Protein Refseq | NP_037386 |
MIM | 604834 |
UniProt ID | Q9UHD2 |
◆ Recombinant Proteins | ||
TBK1-3904Z | Recombinant Zebrafish TBK1 | +Inquiry |
TBK1-4642R | Recombinant Rhesus monkey TBK1 Protein, His-tagged | +Inquiry |
TBK1-335H | Recombinant Human TBK1 protein, GST-tagged | +Inquiry |
TBK1-010H | Active Recombinant Human TBK1 Protein | +Inquiry |
TBK1-4458R | Recombinant Rhesus Macaque TBK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBK1-1745HCL | Recombinant Human TBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBK1 Products
Required fields are marked with *
My Review for All TBK1 Products
Required fields are marked with *