Recombinant Human TBL1 Protein, His-tagged

Cat.No. : TBL1-118H
Product Overview : Recombinant Human TBL1 Protein, fused to His-tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene.
Form : Supplied as a 0.2 μm filtered solution in 20mM Tris, 0.15M NaCl (pH8.0)
Molecular Mass : ~8.8 kDa
AA Sequence : MSITSDEVNFLVYRYLQESGFSHSAATFGIESHISQSNINGTLVPPSALISILQKGLQYV EAEISINKDGT
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/ml
Gene Name TBL1X transducin beta like 1 X-linked [ Homo sapiens (human) ]
Official Symbol TBL1X
Synonyms EBI; TBL1; CHNG8; SMAP55
Gene ID 6907
mRNA Refseq NM_001139466
Protein Refseq NP_001132938
MIM 300196
UniProt ID O60907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBL1X Products

Required fields are marked with *

My Review for All TBL1X Products

Required fields are marked with *

0

Inquiry Basket

cartIcon