Recombinant Human TBL1 Protein, His-tagged
Cat.No. : | TBL1-118H |
Product Overview : | Recombinant Human TBL1 Protein, fused to His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. |
Form : | Supplied as a 0.2 μm filtered solution in 20mM Tris, 0.15M NaCl (pH8.0) |
Molecular Mass : | ~8.8 kDa |
AA Sequence : | MSITSDEVNFLVYRYLQESGFSHSAATFGIESHISQSNINGTLVPPSALISILQKGLQYV EAEISINKDGT |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.8 mg/ml |
Gene Name | TBL1X transducin beta like 1 X-linked [ Homo sapiens (human) ] |
Official Symbol | TBL1X |
Synonyms | EBI; TBL1; CHNG8; SMAP55 |
Gene ID | 6907 |
mRNA Refseq | NM_001139466 |
Protein Refseq | NP_001132938 |
MIM | 300196 |
UniProt ID | O60907 |
◆ Recombinant Proteins | ||
TBL1X-747C | Recombinant Cynomolgus Monkey TBL1X Protein, His (Fc)-Avi-tagged | +Inquiry |
TBL1-118H | Recombinant Human TBL1 Protein, His-tagged | +Inquiry |
TBL1X-5323Z | Recombinant Zebrafish TBL1X | +Inquiry |
TBL1X-99H | Recombinant Human TBL1X protein, His-tagged | +Inquiry |
TBL1X-3951C | Recombinant Chicken TBL1X | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBL1X-1214HCL | Recombinant Human TBL1X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBL1X Products
Required fields are marked with *
My Review for All TBL1X Products
Required fields are marked with *
0
Inquiry Basket