| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. |
| Form : |
Supplied as a 0.2 μm filtered solution in 20mM Tris, 0.15M NaCl (pH8.0) |
| Molecular Mass : |
~8.8 kDa |
| AA Sequence : |
MSITSDEVNFLVYRYLQESGFSHSAATFGIESHISQSNINGTLVPPSALISILQKGLQYV EAEISINKDGT |
| Purity : |
>90% |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.8 mg/ml |
