Recombinant Human TBX19 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TBX19-4873H |
Product Overview : | TBX19 MS Standard C13 and N15-labeled recombinant protein (NP_005140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TBX19 T-box 19 [ Homo sapiens (human) ] |
Official Symbol | TBX19 |
Synonyms | TBX19; T-box 19; T-box transcription factor TBX19; dj747L4.1; TBS 19; TPIT; T-box protein 19; T-box factor, pituitary; TBS19; dJ747L4.1; FLJ26302; FLJ34085; FLJ34543; |
Gene ID | 9095 |
mRNA Refseq | NM_005149 |
Protein Refseq | NP_005140 |
MIM | 604614 |
UniProt ID | O60806 |
◆ Recombinant Proteins | ||
TBX19-6509C | Recombinant Chicken TBX19 | +Inquiry |
TBX19-16527M | Recombinant Mouse TBX19 Protein | +Inquiry |
TBX19-658HFL | Active Recombinant Full Length Human TBX19 Protein, C-Flag-tagged | +Inquiry |
Tbx19-6319M | Recombinant Mouse Tbx19 Protein, Myc/DDK-tagged | +Inquiry |
TBX19-2162H | Recombinant Human TBX19 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX19-1203HCL | Recombinant Human TBX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBX19 Products
Required fields are marked with *
My Review for All TBX19 Products
Required fields are marked with *
0
Inquiry Basket