Recombinant Human TCEA1

Cat.No. : TCEA1-30068TH
Product Overview : Recombinant fragment of Human TCEA1 with an N terminal proprietary tag; Predicted MWt 37.18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 105 amino acids
Description : Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene.
Molecular Weight : 37.180kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDM
Sequence Similarities : Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger.
Gene Name TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ]
Official Symbol TCEA1
Synonyms TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS;
Gene ID 6917
mRNA Refseq NM_006756
Protein Refseq NP_006747
MIM 601425
Uniprot ID P23193
Chromosome Location 8q11.2
Pathway DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem;
Function DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCEA1 Products

Required fields are marked with *

My Review for All TCEA1 Products

Required fields are marked with *

0
cart-icon