Recombinant Human TCEA1

• Cat.No.: TCEA1-30068TH
• Product Overview: Recombinant fragment of Human TCEA1 with an N terminal proprietary tag; Predicted MWt 37.18 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 105 amino acids
• Description: Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene.
• Molecular Weight: 37.180kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDM
• Sequence Similarities: Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger.

Gene Information

• Gene Name: TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ]
• Official Symbol: TCEA1
• Synonyms: TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS
• Gene ID: 6917
• mRNA Refseq: NM_006756
• Protein Refseq: NP_006747
• MIM: 601425
• Uniprot ID: P23193
• Chromosome Location: 8q11.2
• Pathway: DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem
• Function: DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding