Recombinant Human TCEA1
| Cat.No. : | TCEA1-30068TH |
| Product Overview : | Recombinant fragment of Human TCEA1 with an N terminal proprietary tag; Predicted MWt 37.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 105 amino acids |
| Description : | Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene. |
| Molecular Weight : | 37.180kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDM |
| Sequence Similarities : | Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger. |
| Gene Name | TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ] |
| Official Symbol | TCEA1 |
| Synonyms | TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS; |
| Gene ID | 6917 |
| mRNA Refseq | NM_006756 |
| Protein Refseq | NP_006747 |
| MIM | 601425 |
| Uniprot ID | P23193 |
| Chromosome Location | 8q11.2 |
| Pathway | DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; |
| Function | DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| TCEA1-10356Z | Recombinant Zebrafish TCEA1 | +Inquiry |
| TCEA1-6769H | Recombinant Human Transcription Elongation Factor A (SII), 1, His-tagged | +Inquiry |
| TCEA1-5411H | Recombinant Human TCEA1 protein, His-tagged | +Inquiry |
| TCEA1-16540M | Recombinant Mouse TCEA1 Protein | +Inquiry |
| TCEA1-1208H | Recombinant Human TCEA1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCEA1-442HKCL | Human TCEA1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEA1 Products
Required fields are marked with *
My Review for All TCEA1 Products
Required fields are marked with *



