Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TCEA1

Cat.No. : TCEA1-30068TH
Product Overview : Recombinant fragment of Human TCEA1 with an N terminal proprietary tag; Predicted MWt 37.18 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene.
Protein length : 105 amino acids
Molecular Weight : 37.180kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDM
Sequence Similarities : Belongs to the TFS-II family.Contains 1 TFIIS central domain.Contains 1 TFIIS N-terminal domain.Contains 1 TFIIS-type zinc finger.
Gene Name : TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ]
Official Symbol : TCEA1
Synonyms : TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS;
Gene ID : 6917
mRNA Refseq : NM_006756
Protein Refseq : NP_006747
MIM : 601425
Uniprot ID : P23193
Chromosome Location : 8q11.2
Pathway : DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem;
Function : DNA binding; metal ion binding; translation elongation factor activity; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends