Recombinant Human TCEB1
Cat.No. : | TCEB1-30815TH |
Product Overview : | Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 112 amino acids |
Description : | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. |
Molecular Weight : | 38.060kDa inclusive of tags |
Tissue specificity : | Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
Sequence Similarities : | Belongs to the SKP1 family. |
Gene Name | TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ] |
Official Symbol | TCEB1 |
Synonyms | TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII; |
Gene ID | 6921 |
mRNA Refseq | NM_001204863 |
Protein Refseq | NP_001191792 |
MIM | 600788 |
Uniprot ID | Q15369 |
Chromosome Location | 8q13.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
TCEB1-8786H | Recombinant Human TCEB1 protein, His-tagged | +Inquiry |
TCEB1-9074M | Recombinant Mouse TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEB1-30815TH | Recombinant Human TCEB1 | +Inquiry |
TCEB1-4832H | Recombinant Human Transcription Elongation Factor B (SIII), Polypeptide 1 (15kDa, elongin C), His-tagged | +Inquiry |
TCEB1-521HF | Recombinant Full Length Human TCEB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEB1 Products
Required fields are marked with *
My Review for All TCEB1 Products
Required fields are marked with *
0
Inquiry Basket