Recombinant Human TCEB1
| Cat.No. : | TCEB1-30815TH |
| Product Overview : | Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 112 amino acids |
| Description : | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified. |
| Molecular Weight : | 38.060kDa inclusive of tags |
| Tissue specificity : | Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
| Sequence Similarities : | Belongs to the SKP1 family. |
| Gene Name | TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ] |
| Official Symbol | TCEB1 |
| Synonyms | TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII; |
| Gene ID | 6921 |
| mRNA Refseq | NM_001204863 |
| Protein Refseq | NP_001191792 |
| MIM | 600788 |
| Uniprot ID | Q15369 |
| Chromosome Location | 8q13.3 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| TCEB1-9074M | Recombinant Mouse TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TCEB1-3153H | Recombinant Human TCEB1 protein, GST-tagged | +Inquiry |
| TCEB1-4832H | Recombinant Human Transcription Elongation Factor B (SIII), Polypeptide 1 (15kDa, elongin C), His-tagged | +Inquiry |
| TCEB1-16550M | Recombinant Mouse TCEB1 Protein | +Inquiry |
| TCEB1-4467R | Recombinant Rhesus Macaque TCEB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCEB1-1189HCL | Recombinant Human TCEB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCEB1 Products
Required fields are marked with *
My Review for All TCEB1 Products
Required fields are marked with *
