Recombinant Human TCHH protein, His&Myc-tagged
Cat.No. : | TCHH-765H |
Product Overview : | Recombinant Human TCHH protein(Q07283)(1854-1943aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1854-1943aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEYIQEQRSQYRP |
Gene Name | TCHH trichohyalin [ Homo sapiens ] |
Official Symbol | TCHH |
Synonyms | THH; THL; TRHY |
Gene ID | 7062 |
mRNA Refseq | NM_007113.2 |
Protein Refseq | NP_009044.2 |
MIM | 190370 |
UniProt ID | Q07283 |
◆ Recombinant Proteins | ||
TCHH-499H | Recombinant Human TCHH Protein, His-tagged | +Inquiry |
TCHH-765H | Recombinant Human TCHH protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCHH Products
Required fields are marked with *
My Review for All TCHH Products
Required fields are marked with *
0
Inquiry Basket