Recombinant Human TCL1A protein, GST-tagged
Cat.No. : | TCL1A-3160H |
Product Overview : | Recombinant Human TCL1A protein(1-114 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-114 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TCL1A T-cell leukemia/lymphoma 1A [ Homo sapiens ] |
Official Symbol | TCL1A |
Synonyms | TCL1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL1; oncogene TCL1; oncogene TCL-1; protein p14 TCL1; T-cell lymphoma-1; T-cell lymphoma-1A; |
Gene ID | 8115 |
mRNA Refseq | NM_001098725 |
Protein Refseq | NP_001092195 |
MIM | 186960 |
UniProt ID | P56279 |
◆ Recombinant Proteins | ||
Tcl1a-743M | Recombinant Mouse Tcl1a protein, His&Myc-tagged | +Inquiry |
TCL1A-6613H | Recombinant Human TCL1A Protein (Met1-Asp114), N-His tagged | +Inquiry |
TCL1A-1404H | Recombinant Human T-cell Leukemia/lymphoma 1A | +Inquiry |
TCL1A-3160H | Recombinant Human TCL1A protein, GST-tagged | +Inquiry |
TCL1A-1194H | Recombinant Human TCL1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCL1A-1174HCL | Recombinant Human TCL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCL1A Products
Required fields are marked with *
My Review for All TCL1A Products
Required fields are marked with *