Recombinant Human TCL1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TCL1A-1194H
• Product Overview: TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha or TCR-beta regulatory elements. In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT.
• Molecular Mass: 13.5 kDa
• AA Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TCL1A T-cell leukemia/lymphoma 1A [ Homo sapiens (human) ]
• Official Symbol: TCL1A
• Synonyms: TCL1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL1; oncogene TCL1; oncogene TCL-1; protein p14 TCL1; T-cell lymphoma-1; T-cell lymphoma-1A
• Gene ID: 8115
• mRNA Refseq: NM_001098725
• Protein Refseq: NP_001092195
• MIM: 186960
• UniProt ID: P56279