Recombinant Human TCL1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TCL1A-1194H |
Product Overview : | TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha or TCR-beta regulatory elements. In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT. |
Molecular Mass : | 13.5 kDa |
AA Sequence : | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TCL1A T-cell leukemia/lymphoma 1A [ Homo sapiens (human) ] |
Official Symbol | TCL1A |
Synonyms | TCL1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL1; oncogene TCL1; oncogene TCL-1; protein p14 TCL1; T-cell lymphoma-1; T-cell lymphoma-1A; |
Gene ID | 8115 |
mRNA Refseq | NM_001098725 |
Protein Refseq | NP_001092195 |
MIM | 186960 |
UniProt ID | P56279 |
◆ Recombinant Proteins | ||
Tcl1a-743M | Recombinant Mouse Tcl1a protein, His&Myc-tagged | +Inquiry |
TCL1A-3160H | Recombinant Human TCL1A protein, GST-tagged | +Inquiry |
TCL1A-1404H | Recombinant Human T-cell Leukemia/lymphoma 1A | +Inquiry |
Tcl1a-2119R | Recombinant Rat Tcl1a Protein, His-tagged | +Inquiry |
TCL1A-2903H | Recombinant Human TCL1A, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCL1A-1174HCL | Recombinant Human TCL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCL1A Products
Required fields are marked with *
My Review for All TCL1A Products
Required fields are marked with *