Recombinant Human TCL1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TCL1A-1194H
Product Overview : TCL1A MS Standard C13 and N15-labeled recombinant protein (NP_001092195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha or TCR-beta regulatory elements. In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT.
Molecular Mass : 13.5 kDa
AA Sequence : MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TCL1A T-cell leukemia/lymphoma 1A [ Homo sapiens (human) ]
Official Symbol TCL1A
Synonyms TCL1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL1; oncogene TCL1; oncogene TCL-1; protein p14 TCL1; T-cell lymphoma-1; T-cell lymphoma-1A;
Gene ID 8115
mRNA Refseq NM_001098725
Protein Refseq NP_001092195
MIM 186960
UniProt ID P56279

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCL1A Products

Required fields are marked with *

My Review for All TCL1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon