Recombinant Human TCN2 protein(1-200aa), His-GST-tagged
Cat.No. : | TCN2-5730H |
Product Overview : | Recombinant Human TCN2 protein(P20062)(1-200aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-200aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDRLSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSMGQLALYLLALRANCEFVRGHKGDRLVSQLKWFLEDEKRAIGHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFHQGHHSVDTAAMAG |
Gene Name | TCN2 transcobalamin II [ Homo sapiens ] |
Official Symbol | TCN2 |
Synonyms | TCN2; transcobalamin II; transcobalamin II; macrocytic anemia; transcobalamin-2; D22S676; D22S750; macrocytic anemia; TC2; vitamin B12-binding protein 2; II; TC; TC-2; TCII; TC II; |
Gene ID | 6948 |
mRNA Refseq | NM_000355 |
Protein Refseq | NP_000346 |
MIM | 613441 |
UniProt ID | P20062 |
◆ Recombinant Proteins | ||
TCN2-873H | Active Recombinant Human TCN2 protein(Met1-Trp427), His-tagged | +Inquiry |
TCN2-5991R | Recombinant Rat TCN2 Protein | +Inquiry |
TCN2-6405H | Recombinant Human TCN2 Protein (Glu19-Trp427), His tagged | +Inquiry |
Tcn2-571R | Recombinant Rat Tcn2 Protein, His-tagged | +Inquiry |
TCN2-6639Z | Recombinant Zebrafish TCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCN2-2772HCL | Recombinant Human TCN2 cell lysate | +Inquiry |
TCN2-001HCL | Recombinant Human TCN2 cell lysate | +Inquiry |
TCN2-1857MCL | Recombinant Mouse TCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCN2 Products
Required fields are marked with *
My Review for All TCN2 Products
Required fields are marked with *
0
Inquiry Basket