Recombinant Human TDO2 protein, His-SUMO-tagged
Cat.No. : | TDO2-3558H |
Product Overview : | Recombinant Human TDO2 protein(P48775)(1-406aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-406aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens ] |
Official Symbol | TDO2 |
Synonyms | TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO; |
Gene ID | 6999 |
mRNA Refseq | NM_005651 |
Protein Refseq | NP_005642 |
MIM | 191070 |
UniProt ID | P48775 |
◆ Recombinant Proteins | ||
TDO2-5997R | Recombinant Rat TDO2 Protein | +Inquiry |
TDO2-7413HFL | Recombinant Full Length Human TDO2, Flag-tagged | +Inquiry |
TDO2-16601M | Recombinant Mouse TDO2 Protein | +Inquiry |
TDO2-824H | Active Recombinant Human TDO2, MYC/DDK-tagged | +Inquiry |
TDO2-3557H | Recombinant Human TDO2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDO2 Products
Required fields are marked with *
My Review for All TDO2 Products
Required fields are marked with *
0
Inquiry Basket