Recombinant Human TEKT4P2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TEKT4P2-4468H
• Product Overview: LOC100132288 MS Standard C13 and N15-labeled recombinant protein (NP_001028687) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TEKT4P2 (Tektin 4 Pseudogene 2) is a Pseudogene.
• Molecular Mass: 14.9 kDa
• AA Sequence: MFPVSSGCFQEQQETNKSLPRSASTPETRTKFTQDNLCHAQRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAFGCRCEELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKDKEEPLHIAQTRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TEKT4P2 tektin 4 pseudogene 2 [ Homo sapiens (human) ]
• Official Symbol: TEKT4P2
• Synonyms: TEKT4P2; tektin 4 pseudogene 2; MAFIPL; TEKT4P; Tektin-4 like protein LOC389833; FLJ00219; FLJ35473; FLJ39633; MGC90442
• Gene ID: 100132288
• mRNA Refseq: NM_001033515
• Protein Refseq: NP_001028687