Recombinant Human TERT protein(241-310 aa), C-His-tagged
Cat.No. : | TERT-2459H |
Product Overview : | Recombinant Human TERT protein(O14746)(241-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 241-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPST |
Gene Name | TERT telomerase reverse transcriptase [ Homo sapiens ] |
Official Symbol | TERT |
Synonyms | TERT; telomerase reverse transcriptase; EST2; hEST2; TCS1; TP2; TRT; telomerase catalytic subunit; telomerase-associated protein 2; hTRT; DKCA2; DKCB4; |
Gene ID | 7015 |
mRNA Refseq | NM_001193376 |
Protein Refseq | NP_001180305 |
UniProt ID | O14746 |
◆ Recombinant Proteins | ||
TERT-560H | Human Telomerase reverse transcriptase peptide | +Inquiry |
TERT-5744H | Recombinant Human TERT protein, His-tagged | +Inquiry |
Tert-440R | Recombinant Rat Tert Protein, His-tagged | +Inquiry |
Tert-550H | Recombinant Human Tert | +Inquiry |
TERT-9132M | Recombinant Mouse TERT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TERT-1144HCL | Recombinant Human TERT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TERT Products
Required fields are marked with *
My Review for All TERT Products
Required fields are marked with *
0
Inquiry Basket