Recombinant Human TERT protein(241-310 aa), C-His-tagged
| Cat.No. : | TERT-2459H |
| Product Overview : | Recombinant Human TERT protein(O14746)(241-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 241-310 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPST |
| Gene Name | TERT telomerase reverse transcriptase [ Homo sapiens ] |
| Official Symbol | TERT |
| Synonyms | TERT; telomerase reverse transcriptase; EST2; hEST2; TCS1; TP2; TRT; telomerase catalytic subunit; telomerase-associated protein 2; hTRT; DKCA2; DKCB4; |
| Gene ID | 7015 |
| mRNA Refseq | NM_001193376 |
| Protein Refseq | NP_001180305 |
| UniProt ID | O14746 |
| ◆ Recombinant Proteins | ||
| Tert-439M | Recombinant Mouse Tert Protein, His/GST-tagged | +Inquiry |
| TERT-5743H | Recombinant Human TERT protein, GST-tagged | +Inquiry |
| TERT-6014R | Recombinant Rat TERT Protein | +Inquiry |
| TERT-6412H | Recombinant Human TERT Protein (Arg787-Arg1084), N-GST tagged | +Inquiry |
| TERT-056H | Recombinant Human TERT protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TERT-1144HCL | Recombinant Human TERT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TERT Products
Required fields are marked with *
My Review for All TERT Products
Required fields are marked with *



