Recombinant Human TERT protein, GST-tagged
Cat.No. : | TERT-5743H |
Product Overview : | Recombinant Human TERT protein(219-320 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 219-320 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTP |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TERT telomerase reverse transcriptase [ Homo sapiens ] |
Official Symbol | TERT |
Synonyms | TERT; telomerase reverse transcriptase; EST2; hEST2; TCS1; TP2; TRT; telomerase catalytic subunit; telomerase-associated protein 2; hTRT; DKCA2; DKCB4; |
mRNA Refseq | NM_001193376 |
Protein Refseq | NP_001180305 |
UniProt ID | O14746 |
Gene ID | 7015 |
◆ Recombinant Proteins | ||
TERT-438H | Recombinant Human TERT Protein, His-GST-tagged | +Inquiry |
TERT-5744H | Recombinant Human TERT protein, His-tagged | +Inquiry |
TERT-4175H | Recombinant Human TERT Protein, His (Fc)-Avi-tagged | +Inquiry |
TERT-5473Z | Recombinant Zebrafish TERT | +Inquiry |
Tert-440R | Recombinant Rat Tert Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TERT-1144HCL | Recombinant Human TERT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TERT Products
Required fields are marked with *
My Review for All TERT Products
Required fields are marked with *