Recombinant Human TET1 Protein, GST-tagged
| Cat.No. : | TET1-2207H |
| Product Overview : | Human TET1 partial ORF ( NP_085128.1, 2038 a.a. - 2136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the DNA methylation process and gene activation. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TET1 tet methylcytosine dioxygenase 1 [ Homo sapiens (human) ] |
| Official Symbol | TET1 |
| Synonyms | TET1; LCX; CXXC6; bA119F7.1; tet methylcytosine dioxygenase 1; methylcytosine dioxygenase TET1; CXXC finger 6; tet oncogene 1; CXXC zinc finger 6; ten-eleven translocation-1; CXXC-type zinc finger protein 6; ten-eleven translocation 1 gene protein; leukemia-associated protein with a CXXC domain; EC 1.14.11.n2 |
| Gene ID | 80312 |
| mRNA Refseq | NM_030625 |
| Protein Refseq | NP_085128 |
| MIM | 607790 |
| UniProt ID | Q8NFU7 |
| ◆ Recombinant Proteins | ||
| TET1-997H | Active Recombinant Human TET1, Flag-tagged | +Inquiry |
| TET1-2207H | Recombinant Human TET1 Protein, GST-tagged | +Inquiry |
| TET1-235H | Recombinant Human TET1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TET1 Products
Required fields are marked with *
My Review for All TET1 Products
Required fields are marked with *
