Recombinant Human TEX101 Protein, His&ABP tagged

• Cat.No.: TEX101-12H
• Product Overview: Recombinant Human TEX101 Protein (25-99 aa) with His&ABP tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: ABP&His
• Protein Length: 25-99 aa
• Description: May play a role in signal transduction and promote protein tyrosine phosphorylation. Target protein is a glycoprotein whose aggregation induced a rapid increase in tyrosine phosphorylation of Syk kinase and LAT adaptor, calcium flux, and release of secretory components.
• Form: Liquid
• AASequence: ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Applications: Ctrl; BLOCK
• Storage: At -20 centigrade, Avoid Freeze/Thaw Cycles
• Storage Buffer: 1 M urea/PBS, pH 7.4
• Concentration: ≥5.0 mg/mL
• Shipping: Wet ice

Gene Information

• Gene Name: TEX101 testis expressed 101 [ Homo sapiens (human) ]
• Official Symbol: TEX101
• Synonyms: TEX101; testis expressed 101; testis expressed sequence 101; testis-expressed sequence 101 protein; cancer/testis antigen 131; CT131; MGC4766; SGRG; testis-expressed protein 101; cell surface receptor NYD-SP8; testis-specific protein TES101RP; scleroderma-associated autoantigen; spermatogenesis-related gene protein; GTPR867; NYD-SP8; PRO1884; TES101RP
• Gene ID: 83639
• mRNA Refseq: NM_001130011
• Protein Refseq: NP_001123483
• MIM: 612665
• UniProt ID: Q9BY14