Recombinant Human TEX101 Protein, His&ABP tagged

Cat.No. : TEX101-12H
Product Overview : Recombinant Human TEX101 Protein (25-99 aa) with His&ABP tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Protein Length : 25-99 aa
Description : May play a role in signal transduction and promote protein tyrosine phosphorylation. Target protein is a glycoprotein whose aggregation induced a rapid increase in tyrosine phosphorylation of Syk kinase and LAT adaptor, calcium flux, and release of secretory components.
Form : Liquid
AASequence : ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
Purity : >80% by SDS-PAGE and Coomassie blue staining
Applications : Ctrl; BLOCK
Storage : At -20 centigrade, Avoid Freeze/Thaw Cycles
Storage Buffer : 1 M urea/PBS, pH 7.4
Concentration : ≥5.0 mg/mL
Shipping : Wet ice
Gene Name TEX101 testis expressed 101 [ Homo sapiens (human) ]
Official Symbol TEX101
Synonyms TEX101; testis expressed 101; testis expressed sequence 101; testis-expressed sequence 101 protein; cancer/testis antigen 131; CT131; MGC4766; SGRG; testis-expressed protein 101; cell surface receptor NYD-SP8; testis-specific protein TES101RP; scleroderma-associated autoantigen; spermatogenesis-related gene protein; GTPR867; NYD-SP8; PRO1884; TES101RP
Gene ID 83639
mRNA Refseq NM_001130011
Protein Refseq NP_001123483
MIM 612665
UniProt ID Q9BY14

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEX101 Products

Required fields are marked with *

My Review for All TEX101 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon