Recombinant Human TEX101 protein, His-tagged

• Cat.No.: TEX101-30H
• Product Overview: Recombinant Human TEX101 protein(Q9BY14)(Ala41-Thr130), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Ala41-Thr130
• Form: Lyophilized from Phosphate buffered saline.
• Storage: Store at -20 to -80°C。
• Molecular Mass: 12 kDa
• AA Sequence: ANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETT

Gene Information

• Official Symbol: TEX101
• Synonyms: TEX101; testis expressed 101; testis expressed sequence 101; testis-expressed sequence 101 protein; cancer/testis antigen 131; CT131; MGC4766; SGRG; testis-expressed protein 101; cell surface receptor NYD-SP8; testis-specific protein TES101RP; scleroderma-associated autoantigen; spermatogenesis-related gene protein; GTPR867; NYD-SP8; PRO1884; TES101RP
• Gene ID: 83639
• mRNA Refseq: NM_001130011
• Protein Refseq: NP_001123483
• MIM: 612665
• UniProt ID: Q9BY14