Recombinant Human TEX101 protein, His-tagged

Cat.No. : TEX101-30H
Product Overview : Recombinant Human TEX101 protein(Q9BY14)(Ala41-Thr130), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala41-Thr130
Form : Lyophilized from Phosphate buffered saline.
Storage : Store at -20 to -80°C。
Molecular Mass : 12 kDa
AA Sequence : ANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETT
Official Symbol TEX101
Synonyms TEX101; testis expressed 101; testis expressed sequence 101; testis-expressed sequence 101 protein; cancer/testis antigen 131; CT131; MGC4766; SGRG; testis-expressed protein 101; cell surface receptor NYD-SP8; testis-specific protein TES101RP; scleroderma-associated autoantigen; spermatogenesis-related gene protein; GTPR867; NYD-SP8; PRO1884; TES101RP;
Gene ID 83639
mRNA Refseq NM_001130011
Protein Refseq NP_001123483
MIM 612665
UniProt ID Q9BY14

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEX101 Products

Required fields are marked with *

My Review for All TEX101 Products

Required fields are marked with *

0
cart-icon