Recombinant Human TEX101 protein, His-tagged
Cat.No. : | TEX101-30H |
Product Overview : | Recombinant Human TEX101 protein(Q9BY14)(Ala41-Thr130), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala41-Thr130 |
Form : | Lyophilized from Phosphate buffered saline. |
Storage : | Store at -20 to -80°C。 |
Molecular Mass : | 12 kDa |
AA Sequence : | ANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETT |
Official Symbol | TEX101 |
Synonyms | TEX101; testis expressed 101; testis expressed sequence 101; testis-expressed sequence 101 protein; cancer/testis antigen 131; CT131; MGC4766; SGRG; testis-expressed protein 101; cell surface receptor NYD-SP8; testis-specific protein TES101RP; scleroderma-associated autoantigen; spermatogenesis-related gene protein; GTPR867; NYD-SP8; PRO1884; TES101RP; |
Gene ID | 83639 |
mRNA Refseq | NM_001130011 |
Protein Refseq | NP_001123483 |
MIM | 612665 |
UniProt ID | Q9BY14 |
◆ Recombinant Proteins | ||
TEX101-6019R | Recombinant Rat TEX101 Protein | +Inquiry |
TEX101-16656M | Recombinant Mouse TEX101 Protein | +Inquiry |
TEX101-9138M | Recombinant Mouse TEX101 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX101-30H | Recombinant Human TEX101 protein, His-tagged | +Inquiry |
TEX101-3186H | Recombinant Human TEX101, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TEX101-12H | Recombinant Human TEX101 Protein, His&ABP tagged | +Inquiry |
TEX101-20HFL | Recombinant Full Length Human TEX101 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX101-1143HCL | Recombinant Human TEX101 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX101 Products
Required fields are marked with *
My Review for All TEX101 Products
Required fields are marked with *
0
Inquiry Basket