Recombinant Human TEX264 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | TEX264-125H |
Product Overview : | TEX264 MS Standard C13 and N15-labeled recombinant protein (NP_057010) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover. The ATG8-containing isolation membrane (IM) cradles a tubular segment of TEX264-positive ER near a three-way junction, allowing the formation of a synapse of 2 juxtaposed membranes with trans interaction between the TEX264 and ATG8 proteins. Expansion of the IM would extend the capture of ER, possibly through a 'zipper-like' process involving continued trans TEX264-ATG8 interactions, until poorly understood mechanisms lead to the fission of relevant membranes and, ultimately, autophagosomal membrane closure. Also involved in the repair of covalent DNA-protein cross-links (DPCs) during DNA synthesis: acts by bridging VCP/p97 to covalent DNA-protein cross-links (DPCs) and initiating resolution of DPCs by SPRTN. |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TEX264 testis expressed 264, ER-phagy receptor [ Homo sapiens (human) ] |
Official Symbol | TEX264 |
Synonyms | TEX264; testis expressed 264, ER-phagy receptor; ZSIG11; testis-expressed protein 264; testis expressed gene 264; testis-expressed sequence 264 protein |
Gene ID | 51368 |
mRNA Refseq | NM_015926 |
Protein Refseq | NP_057010 |
UniProt ID | Q9Y6I9 |
◆ Recombinant Proteins | ||
TEX264-125H | Recombinant Human TEX264 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
TEX264-5588C | Recombinant Chicken TEX264 | +Inquiry |
TEX264-4489R | Recombinant Rhesus Macaque TEX264 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX264-4673R | Recombinant Rhesus monkey TEX264 Protein, His-tagged | +Inquiry |
Tex264-6366M | Recombinant Mouse Tex264 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEX264-1764HCL | Recombinant Human TEX264 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX264 Products
Required fields are marked with *
My Review for All TEX264 Products
Required fields are marked with *
0
Inquiry Basket