Recombinant Human TEX35 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TEX35-6502H |
| Product Overview : | C1orf49 MS Standard C13 and N15-labeled recombinant protein (NP_115502) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TEX35 (Testis Expressed 35) is a Protein Coding gene. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEIKQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPCALHKKTMAPQKTKQGSLDPLHHCGTCCEKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TEX35 testis expressed 35 [ Homo sapiens (human) ] |
| Official Symbol | TEX35 |
| Synonyms | TEX35; testis expressed 35; TSC24; C1orf49; testis-expressed protein 35; Testis-Specific Conserved gene 24kDa; testis-expressed sequence 35 protein |
| Gene ID | 84066 |
| mRNA Refseq | NM_032126 |
| Protein Refseq | NP_115502 |
| UniProt ID | Q5T0J7 |
| ◆ Recombinant Proteins | ||
| TEX35-758C | Recombinant Cynomolgus Monkey TEX35 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tex35-6369M | Recombinant Mouse Tex35 Protein, Myc/DDK-tagged | +Inquiry |
| TEX35-6502H | Recombinant Human TEX35 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TEX35-653H | Recombinant Human TEX35 Protein, MYC/DDK-tagged | +Inquiry |
| TEX35-1015C | Recombinant Cynomolgus TEX35 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEX35-98HCL | Recombinant Human TEX35 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEX35 Products
Required fields are marked with *
My Review for All TEX35 Products
Required fields are marked with *




