Recombinant Human TEX35 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TEX35-6502H
Product Overview : C1orf49 MS Standard C13 and N15-labeled recombinant protein (NP_115502) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TEX35 (Testis Expressed 35) is a Protein Coding gene.
Molecular Mass : 26.3 kDa
AA Sequence : MSAKRAELKKTHLSKNYKAVCLELKPEPTKTFDYKAVKQEGRFTKAGVTQDLKNELREVREELKEKMEEIKQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPCALHKKTMAPQKTKQGSLDPLHHCGTCCEKCLLCALKNNYNRGNIPSEASGLYKGGEEPVTTQPSVGHAVPAPKSQTEGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TEX35 testis expressed 35 [ Homo sapiens (human) ]
Official Symbol TEX35
Synonyms TEX35; testis expressed 35; TSC24; C1orf49; testis-expressed protein 35; Testis-Specific Conserved gene 24kDa; testis-expressed sequence 35 protein
Gene ID 84066
mRNA Refseq NM_032126
Protein Refseq NP_115502
UniProt ID Q5T0J7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TEX35 Products

Required fields are marked with *

My Review for All TEX35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon