Recombinant Human TFAM, His-tagged
Cat.No. : | TFAM-30255TH |
Product Overview : | Recombinant full length Human mtTFA with N terminal His tag; 225 amino acids with tag, MWt 26.6 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 204 amino acids |
Description : | This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. |
Conjugation : | HIS |
Molecular Weight : | 26.600kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
Sequence Similarities : | Contains 2 HMG box DNA-binding domains. |
Gene Name | TFAM transcription factor A, mitochondrial [ Homo sapiens ] |
Official Symbol | TFAM |
Synonyms | TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; |
Gene ID | 7019 |
mRNA Refseq | NM_003201 |
Protein Refseq | NP_003192 |
MIM | 600438 |
Uniprot ID | Q00059 |
Chromosome Location | 10q21 |
Pathway | Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem; |
Function | DNA binding; chromatin binding; mitochondrial light strand promoter sense binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Tfam-27M | Recombinant Mouse Tfam protein, His/GST-tagged | +Inquiry |
Tfam-655M | Recombinant Mouse Tfam Protein, His/GST-tagged | +Inquiry |
TFAM-4721Z | Recombinant Zebrafish TFAM | +Inquiry |
TFAM-6414H | Recombinant Human TFAM Protein (Ser43-Cys246), N-GST tagged | +Inquiry |
TFAM-1579H | Recombinant Human TFAM protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAM Products
Required fields are marked with *
My Review for All TFAM Products
Required fields are marked with *