Recombinant Human TFAM, His-tagged
| Cat.No. : | TFAM-30255TH |
| Product Overview : | Recombinant full length Human mtTFA with N terminal His tag; 225 amino acids with tag, MWt 26.6 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 204 amino acids |
| Description : | This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. |
| Conjugation : | HIS |
| Molecular Weight : | 26.600kDa inclusive of tags |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
| Sequence Similarities : | Contains 2 HMG box DNA-binding domains. |
| Gene Name | TFAM transcription factor A, mitochondrial [ Homo sapiens ] |
| Official Symbol | TFAM |
| Synonyms | TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2; |
| Gene ID | 7019 |
| mRNA Refseq | NM_003201 |
| Protein Refseq | NP_003192 |
| MIM | 600438 |
| Uniprot ID | Q00059 |
| Chromosome Location | 10q21 |
| Pathway | Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem; |
| Function | DNA binding; chromatin binding; mitochondrial light strand promoter sense binding; protein binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| TFAM-654H | Recombinant Human TFAM Protein, His/GST-tagged | +Inquiry |
| TFAM-301323H | Recombinant Human TFAM protein, GST-tagged | +Inquiry |
| TFAM-16675M | Recombinant Mouse TFAM Protein | +Inquiry |
| TFAM-9148M | Recombinant Mouse TFAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| TFAM-1579H | Recombinant Human TFAM protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFAM-1765HCL | Recombinant Human TFAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAM Products
Required fields are marked with *
My Review for All TFAM Products
Required fields are marked with *
