Recombinant Human TFAP2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TFAP2A-1480H
• Product Overview: TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 47.2 kDa
• AA Sequence: MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TFAP2A transcription factor AP-2 alpha [ Homo sapiens (human) ]
• Official Symbol: TFAP2A
• Synonyms: TFAP2A; transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha); AP2TF, TFAP2, transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); transcription factor AP-2-alpha; AP 2; AP2-alpha; activator protein 2; AP-2 transcription factor; activating enhancer-binding protein 2-alpha; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; FLJ51761
• Gene ID: 7020
• mRNA Refseq: NM_001032280
• Protein Refseq: NP_001027451
• MIM: 107580
• UniProt ID: P05549