Recombinant Human TFAP2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TFAP2A-1480H |
Product Overview : | TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TFAP2A transcription factor AP-2 alpha [ Homo sapiens (human) ] |
Official Symbol | TFAP2A |
Synonyms | TFAP2A; transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha); AP2TF, TFAP2, transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); transcription factor AP-2-alpha; AP 2; AP2-alpha; activator protein 2; AP-2 transcription factor; activating enhancer-binding protein 2-alpha; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; FLJ51761; |
Gene ID | 7020 |
mRNA Refseq | NM_001032280 |
Protein Refseq | NP_001027451 |
MIM | 107580 |
UniProt ID | P05549 |
◆ Recombinant Proteins | ||
TFAP2A-1480H | Recombinant Human TFAP2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TFAP2A-649H | Recombinant Human TFAP2A Protein, MYC/DDK-tagged | +Inquiry |
TFAP2A-3351H | Recombinant Human TFAP2A protein, His-tagged | +Inquiry |
TFAP2A-6651C | Recombinant Chicken TFAP2A | +Inquiry |
TFAP2A-27355TH | Recombinant Human TFAP2A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAP2A-664HCL | Recombinant Human TFAP2A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFAP2A Products
Required fields are marked with *
My Review for All TFAP2A Products
Required fields are marked with *
0
Inquiry Basket