Recombinant Human TFAP2E protein, His-tagged
Cat.No. : | TFAP2E-3551H |
Product Overview : | Recombinant Human TFAP2E protein(58-219 aa), fused to His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 58-219 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YGQAPDAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLLHGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGGITNPGEVFCSVPGRLSL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TFAP2E transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon) [ Homo sapiens ] |
Official Symbol | TFAP2E |
Synonyms | TFAP2E; transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon); transcription factor AP-2-epsilon; AP2E; AP2-epsilon; activating enhancer-binding protein 2-epsilon; adaptor-related protein complex 2, epsilon subunit; MGC49007; |
Gene ID | 339488 |
mRNA Refseq | NM_178548 |
Protein Refseq | NP_848643 |
MIM | 614428 |
UniProt ID | Q6VUC0 |
◆ Recombinant Proteins | ||
TFAP2E-11077Z | Recombinant Zebrafish TFAP2E | +Inquiry |
TFAP2E-9150M | Recombinant Mouse TFAP2E Protein, His (Fc)-Avi-tagged | +Inquiry |
TFAP2E-3551H | Recombinant Human TFAP2E protein, His-tagged | +Inquiry |
TFAP2E-16680M | Recombinant Mouse TFAP2E Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFAP2E-1768HCL | Recombinant Human TFAP2E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAP2E Products
Required fields are marked with *
My Review for All TFAP2E Products
Required fields are marked with *