Recombinant Human TFCP2L1 protein, GST-tagged

Cat.No. : TFCP2L1-3197H
Product Overview : Recombinant Human TFCP2L1 protein(130-479 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 130-479 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : LDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TFCP2L1 transcription factor CP2-like 1 [ Homo sapiens ]
Official Symbol TFCP2L1
Synonyms TFCP2L1; transcription factor CP2-like 1; transcription factor CP2-like protein 1; CRTR1; LBP 9; CRTR-1; transcription factor LBP-9; CP2-related transcriptional repressor 1; LBP9; LBP-9;
Gene ID 29842
mRNA Refseq NM_014553
Protein Refseq NP_055368
MIM 609785
UniProt ID Q9NZI6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFCP2L1 Products

Required fields are marked with *

My Review for All TFCP2L1 Products

Required fields are marked with *

0
cart-icon
0
compare icon