Recombinant Human TFCP2L1 protein, GST-tagged
| Cat.No. : | TFCP2L1-3197H |
| Product Overview : | Recombinant Human TFCP2L1 protein(130-479 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 130-479 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | LDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPVGSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TFCP2L1 transcription factor CP2-like 1 [ Homo sapiens ] |
| Official Symbol | TFCP2L1 |
| Synonyms | TFCP2L1; transcription factor CP2-like 1; transcription factor CP2-like protein 1; CRTR1; LBP 9; CRTR-1; transcription factor LBP-9; CP2-related transcriptional repressor 1; LBP9; LBP-9; |
| Gene ID | 29842 |
| mRNA Refseq | NM_014553 |
| Protein Refseq | NP_055368 |
| MIM | 609785 |
| UniProt ID | Q9NZI6 |
| ◆ Recombinant Proteins | ||
| Tfcp2l1-6376M | Recombinant Mouse Tfcp2l1 Protein, Myc/DDK-tagged | +Inquiry |
| TFCP2L1-3197H | Recombinant Human TFCP2L1 protein, GST-tagged | +Inquiry |
| TFCP2L1-431Z | Recombinant Zebrafish TFCP2L1 | +Inquiry |
| TFCP2L1-3236H | Recombinant Human TFCP2L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFCP2L1-1133HCL | Recombinant Human TFCP2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFCP2L1 Products
Required fields are marked with *
My Review for All TFCP2L1 Products
Required fields are marked with *
