Recombinant Human TFF3 protein, GST-tagged
Cat.No. : | TFF3-3564H |
Product Overview : | Recombinant Human TFF3 protein(Q07654)(29-80aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 29-80aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TFF3 trefoil factor 3 (intestinal) [ Homo sapiens ] |
Official Symbol | TFF3 |
Synonyms | TFF3; trefoil factor 3 (intestinal); trefoil factor 3; HITF; ITF; polypeptide P1.B; P1B; TFI; |
Gene ID | 7033 |
mRNA Refseq | NM_003226 |
Protein Refseq | NP_003217 |
MIM | 600633 |
UniProt ID | Q07654 |
◆ Recombinant Proteins | ||
TFF3-6875D | Recombinant Dog TFF3 protein, His&Myc-tagged | +Inquiry |
TFF3-6322D | Recombinant Dog TFF3 protein, His-tagged | +Inquiry |
TFF3-31608TH | Recombinant Human TFF3 | +Inquiry |
TFF3-3564H | Recombinant Human TFF3 protein, GST-tagged | +Inquiry |
TFF3-5527H | Recombinant Human TFF3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFF3 Products
Required fields are marked with *
My Review for All TFF3 Products
Required fields are marked with *