Recombinant Human TFPI protein, GST-tagged
| Cat.No. : | TFPI-3565H |
| Product Overview : | Recombinant Human TFPI protein(P10646)(29-280aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 29-280aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 55.9 kDa |
| AA Sequence : | DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) [ Homo sapiens ] |
| Official Symbol | TFPI |
| Synonyms | TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin; |
| Gene ID | 7035 |
| mRNA Refseq | NM_001032281 |
| Protein Refseq | NP_001027452 |
| MIM | 152310 |
| UniProt ID | P10646 |
| ◆ Recombinant Proteins | ||
| TFPI-3565H | Recombinant Human TFPI protein, GST-tagged | +Inquiry |
| Tfpi-981M | Active Recombinant Mouse Tfpi protein(Met1-Lys289), His-tagged | +Inquiry |
| TFPI-876H | Recombinant Human TFPI protein, His-tagged, Biotinylated | +Inquiry |
| TFPI-751H | Recombinant Human TFPI Protein, Biotinylated | +Inquiry |
| Tfpi-6383M | Recombinant Mouse Tfpi Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFPI-2843MCL | Recombinant Mouse TFPI cell lysate | +Inquiry |
| TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI Products
Required fields are marked with *
My Review for All TFPI Products
Required fields are marked with *
