Recombinant Human TFPI protein, GST-tagged
Cat.No. : | TFPI-3565H |
Product Overview : | Recombinant Human TFPI protein(P10646)(29-280aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 29-280aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) [ Homo sapiens ] |
Official Symbol | TFPI |
Synonyms | TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin; |
Gene ID | 7035 |
mRNA Refseq | NM_001032281 |
Protein Refseq | NP_001027452 |
MIM | 152310 |
UniProt ID | P10646 |
◆ Recombinant Proteins | ||
TFPI-576R | Recombinant Rabbit TFPI Protein, His/GST-tagged | +Inquiry |
TFPI-3566R | Recombinant Rabbit TFPI protein, His-tagged | +Inquiry |
TFPI-646HB | Recombinant Human TFPI protein, His-Avi-tagged, Biotinylated | +Inquiry |
TFPI-707H | Recombinant Human TFPI Protein, MYC/DDK-tagged | +Inquiry |
TFPI-2333H | Recombinant Human TFPI, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
TFPI-2843MCL | Recombinant Mouse TFPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFPI Products
Required fields are marked with *
My Review for All TFPI Products
Required fields are marked with *
0
Inquiry Basket