Recombinant Human TFRC protein(91-170 aa), C-His-tagged
| Cat.No. : | TFRC-2532H |
| Product Overview : | Recombinant Human TFRC protein(P02786)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVE |
| Gene Name | TFRC transferrin receptor (p90, CD71) [ Homo sapiens ] |
| Official Symbol | TFRC |
| Synonyms | TFRC; transferrin receptor (p90, CD71); transferrin receptor protein 1; CD71; TFR1; T9; TR; TFR; p90; TRFR; |
| Gene ID | 7037 |
| mRNA Refseq | NM_001128148 |
| Protein Refseq | NP_001121620 |
| MIM | 190010 |
| UniProt ID | P02786 |
| ◆ Recombinant Proteins | ||
| TFRC-2124H | Recombinant Human TFRC Protein, His-tagged | +Inquiry |
| TFRC-791H | Recombinant Human TFRC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TFRC-3865H | Active Recombinant Human TFRC Protein, His-tagged, Biotinylated | +Inquiry |
| TFRC-466H | Recombinant Human TFRC Protein, His-tagged, Biotinylated | +Inquiry |
| TFRC-34H | Recombinant Human TFRC Protein, 101-760aa, C-6×His tagged | +Inquiry |
| ◆ Native Proteins | ||
| TFRC-69H | Native Human Apotransferrin | +Inquiry |
| TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
| TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFRC-2058HCL | Recombinant Human TFRC cell lysate | +Inquiry |
| TFRC-1813MCL | Recombinant Mouse TFRC cell lysate | +Inquiry |
| TFRC-950CCL | Recombinant Cynomolgus TFRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFRC Products
Required fields are marked with *
My Review for All TFRC Products
Required fields are marked with *



