Recombinant Human TFRC protein(91-170 aa), C-His-tagged
Cat.No. : | TFRC-2532H |
Product Overview : | Recombinant Human TFRC protein(P02786)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVE |
Gene Name | TFRC transferrin receptor (p90, CD71) [ Homo sapiens ] |
Official Symbol | TFRC |
Synonyms | TFRC; transferrin receptor (p90, CD71); transferrin receptor protein 1; CD71; TFR1; T9; TR; TFR; p90; TRFR; |
Gene ID | 7037 |
mRNA Refseq | NM_001128148 |
Protein Refseq | NP_001121620 |
MIM | 190010 |
UniProt ID | P02786 |
◆ Recombinant Proteins | ||
TFRC-0783H | Recombinant Human TFRC protein, hFc-tagged | +Inquiry |
TFRC-466HFL | Recombinant Full Length Human TFRC Protein, C-Flag-tagged | +Inquiry |
TFRC-333H | Recombinant Human TFRC Protein, Flag-tagged | +Inquiry |
TFRC-2124H | Recombinant Human TFRC Protein, His-tagged | +Inquiry |
TFRC-2029HB | Active Recombinant Human TFRC protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
TFRC-69H | Native Human Apotransferrin | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFRC-1813MCL | Recombinant Mouse TFRC cell lysate | +Inquiry |
TFRC-2058HCL | Recombinant Human TFRC cell lysate | +Inquiry |
TFRC-950CCL | Recombinant Cynomolgus TFRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFRC Products
Required fields are marked with *
My Review for All TFRC Products
Required fields are marked with *