Recombinant Human TG, GST-tagged

Cat.No. : TG-8267H
Product Overview : Human TG partial ORF ( NP_003226, 2659 a.a. - 2768 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
Molecular Mass : 37.84 kDa
AA Sequence : FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKA DCSFWSKYISSLKTSADGA KGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TG thyroglobulin [ Homo sapiens (human) ]
Official Symbol TG
Synonyms TG; TGN; AITD3; thyroglobulin
Gene ID 7038
mRNA Refseq NM_003235
Protein Refseq NP_003226
MIM 188450
UniProt ID P01266
Chromosome Location 8q24
Pathway Autoimmune thyroid disease; Thyroid hormone synthesis
Function NOT carboxylesterase activity; hormone activity; NOT neurexin family protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TG Products

Required fields are marked with *

My Review for All TG Products

Required fields are marked with *

0
cart-icon
0
compare icon